SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|509152275|ref|YP_008064649.1| from Legionella pneumophila subsp. pneumophila str. Thunder Bay

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|509152275|ref|YP_008064649.1|
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily YccV-like 8.76e-25
Family YccV-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|509152275|ref|YP_008064649.1|
Sequence length 103
Comment heat shock protein HspQ [Legionella pneumophila subsp. pneumophila str. Thunder Bay]
Sequence
MNKIAKYNIGDLVIHKRIRYRAIVIDVDPIFQASGKYNPRATQHEFATRNPWYRLLVDDS
SQITYVEECQLLPDTSQEPINNPNIDDYLIKNKGSYQKTIPSH
Download sequence
Identical sequences A0A130WHQ0 Q5WSL9
gi|397665545|ref|YP_006507083.1| WP_011216774.1.101551 WP_011216774.1.17841 WP_011216774.1.17948 WP_011216774.1.23866 WP_011216774.1.25858 WP_011216774.1.27113 WP_011216774.1.27538 WP_011216774.1.28686 WP_011216774.1.2919 WP_011216774.1.30240 WP_011216774.1.3115 WP_011216774.1.33232 WP_011216774.1.34463 WP_011216774.1.37678 WP_011216774.1.39491 WP_011216774.1.40835 WP_011216774.1.4842 WP_011216774.1.4947 WP_011216774.1.50842 WP_011216774.1.54472 WP_011216774.1.55380 WP_011216774.1.57907 WP_011216774.1.58065 WP_011216774.1.59940 WP_011216774.1.62652 WP_011216774.1.67291 WP_011216774.1.67497 WP_011216774.1.696 WP_011216774.1.75285 WP_011216774.1.77106 WP_011216774.1.79384 WP_011216774.1.80284 WP_011216774.1.84310 WP_011216774.1.85821 WP_011216774.1.87029 WP_011216774.1.90718 WP_011216774.1.91183 WP_011216774.1.9248 WP_011216774.1.92599 WP_011216774.1.9284 WP_011216774.1.95895 WP_011216774.1.97848 WP_011216774.1.98916 WP_011216774.1.9955 gi|54295769|ref|YP_128184.1| gi|470180749|ref|YP_007566624.1| gi|509152275|ref|YP_008064649.1| 297245.lpl2859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]