SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525657819|ref|YP_008221274.1| from Mannheimia haemolytica D171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525657819|ref|YP_008221274.1|
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.49e-34
Family Transcriptional regulator Rrf2 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525657819|ref|YP_008221274.1|
Sequence length 150
Comment Rrf2 family transcriptional regulator [Mannheimia haemolytica D171]
Sequence
MKLTSKGRYAVTAILDIALHGKLEPVSLADISDRQAISLSYLEQLFAQLRRDGIVQSVRG
PGGGYQLGKKPEEISLGMIISAVNENIDVTKCKGSGNCRKDSQCLTHSLWERLEDQIEQF
LGTISVADLAAEHADHDCEKEHCHDHPHHH
Download sequence
Identical sequences WP_020831298.1.20456 WP_020831298.1.2132 WP_020831298.1.23336 WP_020831298.1.26880 WP_020831298.1.30596 WP_020831298.1.41844 WP_020831298.1.44810 WP_020831298.1.49495 WP_020831298.1.72771 WP_020831298.1.8479 gi|525657819|ref|YP_008221274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]