SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479183790|ref|YP_007811363.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479183790|ref|YP_007811363.1|
Domain Number 1 Region: 68-136
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000000387
Family DNA helicase RuvA subunit, middle domain 0.021
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000012
Family DNA helicase RuvA subunit, N-terminal domain 0.034
Further Details:      
 
Weak hits

Sequence:  gi|479183790|ref|YP_007811363.1|
Domain Number - Region: 139-181
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.00288
Family DNA helicase RuvA subunit, C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479183790|ref|YP_007811363.1|
Sequence length 186
Comment putative Holliday junction DNA helicase RuvA [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MNDYINGLLHKIDDKYLYIELNNSGYRFLYLKTDLKDLKLNQNNQVYVAINVIDNVFKYY
GFKNQLIRDLFELLININTIGEKTAFLILENYNYNELIDIFKNGRTDKILQLKGIGNYTA
RLIINSVQKELFNNKISDKKNKVITSLEKLGYKTKDIYKIIINIDEDMNIEDLTKYVLEQ
LSYLHN
Download sequence
Identical sequences A0A0F2BKZ9 Q6MT68
NP_975526.1.55851 WP_011166724.1.11018 WP_011166724.1.17500 WP_011166724.1.32010 WP_011166724.1.3214 WP_011166724.1.37196 WP_011166724.1.51345 WP_011166724.1.72634 WP_011166724.1.84266 gi|479183790|ref|YP_007811363.1| 272632.MSC_0542 gi|42561075|ref|NP_975526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]