SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479183798|ref|YP_007811289.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479183798|ref|YP_007811289.1|
Domain Number 1 Region: 1-252
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 8.63e-54
Family NIF3 (NGG1p interacting factor 3)-like 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479183798|ref|YP_007811289.1|
Sequence length 258
Comment dinuclear metal center protein, YbgI family [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MLLDNIISYLNQLFNPKKASNWDHVGFQFEYKKLNNINISKVLVCLDLTNDCLEFAISNQ
TQLIITRHPFIFNELKLEKKNPNKKQMIKKLKKHKILVFSIHTNYDSSIKQNLLEILNKK
LKINSFKKYGKDKESNLFYLDQKISVNDLINDLKEIFSLNKIRLNSNISLDTKIKDFYLT
SGSGASTMIENMLKDCTFITGEVKWDQWIYANSNNVNLIEIGHYAENHFIDDLKNKLEIK
FKDIKIFSYDIKNQFIEK
Download sequence
Identical sequences A0A0F2BQA0 Q6MTE0
NP_975454.1.55851 WP_011166652.1.11018 WP_011166652.1.17500 WP_011166652.1.32010 WP_011166652.1.3214 WP_011166652.1.37196 WP_011166652.1.51345 WP_011166652.1.72634 WP_011166652.1.84266 gi|42561003|ref|NP_975454.1| 272632.MSC_0468 gi|479183798|ref|YP_007811289.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]