SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479183817|ref|YP_007811145.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479183817|ref|YP_007811145.1|
Domain Number 1 Region: 3-223
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.26e-66
Family Pseudouridine synthase II TruB 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479183817|ref|YP_007811145.1|
Sequence length 292
Comment tRNA pseudouridine synthase B [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MQKSGIFILNKPSNISTYQLINQVKKKLNIKKVGHCGTLDLLATGVVICLVNNATKISDY
LLNANKAYQVKIKLFTLTDSFDAEGNIIQTQTPFNISLDQINKVISKYNNYTYNQYPPIY
SSIKVDGKKLYEYALTNQNVEIKSRKVTIYKTSLLSYDQKNYEIFLDVKCSKGTYIRSLA
VDICKDLNTIGYVVYLNRTLSGNFKLENAIDLNNISWDHLISINDAIRTNDFKVVKYQNS
LEIIQGKKIILNDINDDLVFISDDQNNILAVYQKYDNNIFKIKRGGLNNDIY
Download sequence
Identical sequences A0A0F2BLB7 Q6MTR0
gi|42560883|ref|NP_975334.1| NP_975334.1.55851 WP_011166532.1.11018 WP_011166532.1.17500 WP_011166532.1.32010 WP_011166532.1.3214 WP_011166532.1.37196 WP_011166532.1.51345 WP_011166532.1.72634 WP_011166532.1.84266 gi|479183817|ref|YP_007811145.1| 272632.MSC_0336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]