SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479183848|ref|YP_007811081.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479183848|ref|YP_007811081.1|
Domain Number 1 Region: 253-548
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.05e-101
Family Pyruvate phosphate dikinase, C-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 126-249
Classification Level Classification E-value
Superfamily Phosphohistidine domain 3.4e-35
Family N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system 0.0011
Further Details:      
 
Domain Number 3 Region: 24-144
Classification Level Classification E-value
Superfamily Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 1.29e-33
Family Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479183848|ref|YP_007811081.1|
Sequence length 573
Comment phosphoenolpyruvate-protein phosphotransferase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MSKQIKGIAASEGISLARALVIKEIKLDVQKQLIDDVDQQIAKLEQAINQTITDLKKIQK
ITLEKLGEEKAAIFDAHQDIANDPAIKEEVVQLIKTEKVNAEYALFIVSNNYFEMFSQLG
DPYFKERSADIKDISSRIISHILGLEIHDLSTIDKEVIIISDDLTPSQTAQLNKKFVKGF
LTNVGGRTSHAAIMARSLEIPAILGLKNITELVKTDDLIALDGSSGIVELDLNDNDIKNY
QTKVKQYLELKDQLKKFKDKPSLTKDKIKKLIEANIGSTNDIQSVLDSGAEGIGLFRTEF
LYMNNDHFPTEEEQFEAYKKVVSQINHLVVFRTLDIGGDKKLSYFKFDEEMNPFLGYRAI
RFTLDRKDIFKDQIRALLKASAFGKLGIMFPMIATIDEFKQAKAFVEECKIELDKEGIKY
DKQVQIGMMVEIPSAAILADQFAKYADFFSIGTNDLIQYSFASDRMNQNVSYLYQPLNPS
LLRLIQLTISGAHKHNKWVGMCGEMAGDSKALPILLGLDLDAFSMSATSVLKARSLMSKI
ESIKAKDLANKALEYQTSQQVNELVEEFLKNLD
Download sequence
Identical sequences WP_015545277.1.51345 gi|479183848|ref|YP_007811081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]