SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479183900|ref|YP_007811316.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479183900|ref|YP_007811316.1|
Domain Number 1 Region: 153-292
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000428
Family HD domain 0.032
Further Details:      
 
Domain Number 2 Region: 2-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000195
Family Single strand DNA-binding domain, SSB 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479183900|ref|YP_007811316.1|
Sequence length 326
Comment HD domain protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MKKVKDINIEDHLIDTILRIERVIVSTGSSGNNYLILHLADSTGRIEARKWVVSEKDKQL
LKPNTIVLLKDTIVHEYRNILQLKVEDYQVIDEKDLLKYHLNKTDLYITAPLDIKTSYLE
LISLLNSINNQTYKTITLNLIEKYKKEFLTFPAAMSIHHNVTSGLFWHSYTLVKNVLSLK
ENYFYVNIDWDLLICGAILHDIGKVIEISDVNGSDYSLEGKLLGHISIGNAEINKLADKL
NLYKDQNNKINKEITLLQHMILASHGKKEFGSPIEPVLIEAVILSALDDLDAKVYKINDE
LSKIELDNWTQKIISIDNKMFYKHKK
Download sequence
Identical sequences A0A0F2BQD0 Q6MTB1
gi|42561032|ref|NP_975483.1| gi|479183900|ref|YP_007811316.1| 272632.MSC_0497 NP_975483.1.55851 WP_011166681.1.11018 WP_011166681.1.17500 WP_011166681.1.32010 WP_011166681.1.3214 WP_011166681.1.37196 WP_011166681.1.51345 WP_011166681.1.72634 WP_011166681.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]