SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479183938|ref|YP_007811261.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479183938|ref|YP_007811261.1|
Domain Number 1 Region: 152-333
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.47e-50
Family G proteins 0.0000115
Further Details:      
 
Domain Number 2 Region: 2-158
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 2.75e-49
Family Obg GTP-binding protein N-terminal domain 0.00000946
Further Details:      
 
Domain Number 3 Region: 361-433
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 5.1e-19
Family Obg GTP-binding protein C-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479183938|ref|YP_007811261.1|
Sequence length 433
Comment Obg family GTPase CgtA [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MKFVDSADLIIKAGKGGDGAVSFLHALFVPNGGPNGGDGGDGGSVYFQGDEGKHSLLDLK
LQKKYSAQDGFKGDIKNMHGAKGEDKIIKVPVGTILYDKKTNNILADINENNKLVLIAKG
GKGGKGNARFANSRNKAPTIFEAGELGQEFEIRAELKVLADVGFVGLPNAGKSTLLRAIS
NSKPVVADYPFTTITPQLGVARTKNNDTFIVADLPGLIQGASLGKGLGHQFLKHIERCLV
ICHIIDASGNFGSEDIIKNYELIRNELKTYNLNLEKRAEIIVLNKMDLDEAQLNLLDEKI
INYFKNKKVIQISGLKKENIDQLLFMIYEELKVAKKQSLWELDKNNNQDEMVIYKFEEQK
EDIQAYNKGNNRWEIAGETIFKIYQKFPIWTEDNLLMFNEKLKETGVYETLVKKGIKKGD
FVKVFDYELEWTD
Download sequence
Identical sequences A0A126SRK9 Q6MTG9
gi|479183938|ref|YP_007811261.1| 272632.MSC_0439 gi|42560974|ref|NP_975425.1| NP_975425.1.55851 WP_011166623.1.11018 WP_011166623.1.3214 WP_011166623.1.37196 WP_011166623.1.51345 WP_011166623.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]