SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479183986|ref|YP_007811200.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479183986|ref|YP_007811200.1|
Domain Number 1 Region: 66-236
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.18e-34
Family Pseudouridine synthase RsuA/RluD 0.00035
Further Details:      
 
Domain Number 2 Region: 5-56
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000000114
Family Pseudouridine synthase RsuA N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479183986|ref|YP_007811200.1|
Sequence length 252
Comment pseudouridylate synthase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MSLERLQKVISSRGYCSRRAAEKLILENRVKVNDQIINTLGVKIDPKAEIKIDNRLVLSD
SNNQKYYYLFYKPRLVLTTMYDPKKRKTVNDYFKDLNHRVYPVGRLDYDVSGLLLMTNDG
VLFNFIMHPKYEFLKTYQGLCQGQVNKQQINQLIKGVYIDNDYLTKAYSAKLVKYDKLKN
TSIVELTINEGKKHHVKKMFDSIQAQLLKLKRTKIEFLEIADLKPGQYRELKTHEVKRLY
GIYHSLKQNNNK
Download sequence
Identical sequences A0A0F2BJR7
gi|479183986|ref|YP_007811200.1| WP_015545336.1.11018 WP_015545336.1.17500 WP_015545336.1.32010 WP_015545336.1.3214 WP_015545336.1.37196 WP_015545336.1.51345 WP_015545336.1.72634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]