SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184014|ref|YP_007811404.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184014|ref|YP_007811404.1|
Domain Number 1 Region: 81-304
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.35e-71
Family Pseudouridine synthase RsuA/RluD 0.0000104
Further Details:      
 
Domain Number 2 Region: 13-67
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.000000000639
Family Pseudouridine synthase RsuA N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184014|ref|YP_007811404.1|
Sequence length 310
Comment pseudouridine synthase, RluA family [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MNKITLNSLNTTLRLDKLLVELLTSYDYSRSYIQKLIKEECISVNNQIITNNNFLVKPNS
QITITIKDPILDPNLVKNDEIDLDIIYQDDDLLVINKQNNITVHPSLNNTNNTIVNALLA
SDVELSSINGELRPGIVHRIDKQTTGLLIVAKNDKTHKLLSEMFKNHQIYKEYLAIVTGV
IKPNKGLIDAPIGRSQTDRKKMSVTAKNSKQAITTFEVVERFFKNTLVKCQIQTGRTHQI
RVHFNYINHPVLNDPVYGKKHQEFTDFGQYLHAYKLKFTHPITKKEIELISPLPKEFDDK
IKELRGENND
Download sequence
Identical sequences A0A0F2BJQ9 Q6MT30
272632.MSC_0583 NP_975564.1.55851 WP_011166761.1.11018 WP_011166761.1.17500 WP_011166761.1.32010 WP_011166761.1.3214 WP_011166761.1.37196 WP_011166761.1.51345 WP_011166761.1.72634 WP_011166761.1.84266 gi|42561113|ref|NP_975564.1| gi|479184014|ref|YP_007811404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]