SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184026|ref|YP_007811732.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184026|ref|YP_007811732.1|
Domain Number 1 Region: 37-118
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000000105
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.017
Further Details:      
 
Weak hits

Sequence:  gi|479184026|ref|YP_007811732.1|
Domain Number - Region: 136-165
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.051
Family Pancreatic carboxypeptidase, activation domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184026|ref|YP_007811732.1|
Sequence length 180
Comment conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRFEAFGIEGLINKEKKP
YYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYREYGFLGLNNNIGRPKK
IMKNPNKKPTKIKKSQVKINNEQQIKELKEQVEYYKLETEFWKKFHTLLTKEKSTRKKQK
Download sequence
Identical sequences A0A126SQK2 Q6MS74
gi|42561423|ref|NP_975874.1| 272632.MSC_0905 gi|479184026|ref|YP_007811732.1| NP_975874.1.55851 WP_011167056.1.11018 WP_011167056.1.3214 WP_011167056.1.37196 WP_011167056.1.51345 WP_011167056.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]