SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184040|ref|YP_007811241.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184040|ref|YP_007811241.1|
Domain Number 1 Region: 280-431
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.65e-30
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 168-266
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000506
Family Eukaryotic type KH-domain (KH-domain type I) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184040|ref|YP_007811241.1|
Sequence length 482
Comment conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MYLWKSKSRKRLVEQYTKEAKQAKKQILANGYKEISEAKMLFLKRSELEKNELDRVKEQL
ELRSNDLKRNQEIVESKSQRLDASLLDLEKRKFLLDKKEEYLIKILEDASGLTKSQAKEL
LIKQVKNKSEKELISILKNAELQAHSSSKMIANNIIISAMERIKVELTSQRTTNIVKLPS
DDLKGRIIGKDGRNMKAFEQIGGVDIVVDETPNTVVVSSFNPIRREIATRTLEQLIIDGR
IQPIKIENELKKQEQELEYIIQETGLSTIKELNINDIDIELVKLIGKLKFRTSYGQNVLA
HSIEVAKLSGAIASELGLDVEKAIRAGLLHDIGKAIDFEKQGSHVVLGAEIAKKYNEDPI
IINCIESHHEDKEKESEIAAIVAIADSISASRPGARYNAIDEFILRMTEIEKIGNSIPGV
AKTYALQSGRQIRLIVNPLVASDLDLAMILEKMKEEIKNKVIIPGEITITVIRERKETDV
LK
Download sequence
Identical sequences gi|392389042|ref|YP_005907451.1| gi|479184040|ref|YP_007811241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]