SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184042|ref|YP_007810822.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184042|ref|YP_007810822.1|
Domain Number 1 Region: 166-440
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.06e-69
Family Extended AAA-ATPase domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 420-609
Classification Level Classification E-value
Superfamily FtsH protease domain-like 4.19e-59
Family FtsH protease domain-like 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184042|ref|YP_007810822.1|
Sequence length 648
Comment ATP-dependent metallopeptidase HflB [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MNKKKKKSTFWFWIILIIGFIILLSVISITSRGTTQNLTIEQLYNLFDQGKPLNNVVLQR
NNIQGIDIITGWYNNGSGWTKFTVNTNPNAINGFSDAFKNFVWRSNTTRYTESSWFSLLS
SLLPMLILILFYIGLFYFMAKSGAAGAGASGLFGMGKNKARREKSNVKFSDVAGIEEEKL
ELVELVDYLKQPAKYASAGARAPKGVLMEGPPGTGKTLLAKAVAGEANVSFFSIAGSEFE
EMFVGVGASRVREMFNEAKKAAPAIIFIDEIDAVGRKRNSAIGTGTNEQTLNQLLVELDG
FETNSGIIVMAATNRVDVLDPALLRPGRFDRVIQVSLPDIKEREQILKLHARNKKIDPSI
DWHRIAERTPGFSGAQLENVLNEAAILMVREGKTVIGINEIDEAIDRVVGGPAKKSRAMT
MHDKEIVSYHESGHALIGLKLESASKVQKVTIIPRGNAGGYTIMTPKDETLFSSKTDLYA
MIAGYLGGRAAEEIKFGKDNVTTGAHDDFDKATAIARRMVMQFGMSELGITKFLTMADEA
YGKTEGSYSEKTAAKIDAEVERILEESYKLAIKVISENMETLELLAESLRILETITAEQI
DYINKNKKLPEAVIYEKEKYKQEQEKINSGKIIDLDINDVKEDNKENN
Download sequence
Identical sequences gi|479184042|ref|YP_007810822.1| WP_015545357.1.17500 WP_015545357.1.32010 WP_015545357.1.3214 WP_015545357.1.37196 WP_015545357.1.51345 WP_015545357.1.72634 WP_015545357.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]