SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184110|ref|YP_007811851.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184110|ref|YP_007811851.1|
Domain Number 1 Region: 2-66,97-260
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.02e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.03
Further Details:      
 
Weak hits

Sequence:  gi|479184110|ref|YP_007811851.1|
Domain Number - Region: 463-539
Classification Level Classification E-value
Superfamily X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain 0.0889
Family X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479184110|ref|YP_007811851.1|
Sequence length 629
Comment tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MKSNYDVIVVGGGHAGVEAALASARLNKKTALINLYEDKIATMPCNPSVGGPAKGIVVRE
IDALGGEMAKAADATALQTKLLNSSRGPGVWALRVQSDKEEYSKYMRNVIKNQKNLDLIT
RACTGLVYDENKTVTGIYLDDQTILNAKAVIITTGTYLKSEILKGVDRYESGPNNEKTTK
GISQSLIDLGIKLMRFKTGTPARVYRDSVDLSNAVLEPGTDMKLAFSFSTSTYTPIEKQQ
PCYLIHSTLETKKIIEDNLEKSAMYSGTVESIGPRYCPSFEDKAVRFREKDTHQIFIEPE
TLNGDTWYVQGFSTSMPIEVQEMMLKSLPGFENVRVKHWAYAIEYDCIDPMQLSPSLELK
DVKNLFTAGQINGTSGYEEAAGQGLIAGINASRKIDGLDPIILRRDEAYIGVMIDDLINK
GVWEPYRLLTSRAEHRLLLRNDNAETRLKQYGKEIGLISDQEWNQYLIYVKEIEQAIKEL
KEIRFTPKSQLAINLKNKNQADLSHGYSGYEIIKIPTVDINELIEFIPSLQKLKTNQLQS
IVIEIRFEGYVKKERQLVDKLVKLERKKIPLDINYSKVDNLATEAKDKLEKIRPLNIGQA
SRITGVNPADIQMLLFYLKKQYPLENIDN
Download sequence
Identical sequences A0A0F2BKF9
WP_015545387.1.11018 WP_015545387.1.17500 WP_015545387.1.32010 WP_015545387.1.3214 WP_015545387.1.37196 WP_015545387.1.51345 WP_015545387.1.72634 WP_015545387.1.84266 gi|479184110|ref|YP_007811851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]