SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184164|ref|YP_007811555.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184164|ref|YP_007811555.1|
Domain Number 1 Region: 117-194
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.14e-24
Family Translational machinery components 0.00014
Further Details:      
 
Domain Number 2 Region: 45-113
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.57e-23
Family Ribosomal S5 protein, N-terminal domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479184164|ref|YP_007811555.1|
Sequence length 254
Comment ribosomal protein S5 [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MTEEMNVVETSSEMNSNVEKASTQVKETKKFERRTRPQSKSKQVKDEFEEKVVTIRRVTK
VTKGGRHFRFAAVVVVGNKKGLVGMGTGKANEVPEAIKKAIKEAKKNLVSVTLRNTTVPH
EVLGTFGAGKILIKPAKVGTGIIAGGPARAVIELAGISDVYAKSLGSNNAINMIRATFEG
LSSMQTLKRVQELRYGKTFDTQKVKPVEQKVAEVKGVEKKQPKQAVKKVAVKKAENQENR
VEVITNAETESKAE
Download sequence
Identical sequences Q6MSP2
gi|479184164|ref|YP_007811555.1| gi|42561253|ref|NP_975704.1| NP_975704.1.55851 WP_011166896.1.17500 WP_011166896.1.32010 WP_011166896.1.3214 WP_011166896.1.37196 WP_011166896.1.51345 WP_011166896.1.72634 WP_011166896.1.84266 272632.MSC_0728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]