SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184184|ref|YP_007811437.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184184|ref|YP_007811437.1|
Domain Number 1 Region: 4-197
Classification Level Classification E-value
Superfamily ITPase-like 2.12e-54
Family ITPase (Ham1) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479184184|ref|YP_007811437.1|
Sequence length 200
Comment non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MDKKVIYLATTNKNKVKEFSEILKDYQIKSLLDIPEYVEIEENKKTFKQNALLKAKHLAK
YINGVAIGDDTGICVKALNDFPGIYSKRWAYPLTNHYDICNKLLDKLKHINQLNKRKAYM
TTAIALYDAINKKQFVYQARVNGYIDFQVNESEFGFGYDFIFIPKGYDKAYSLMNSELKN
QISARKKAIDKLIEYIDNVK
Download sequence
Identical sequences A0A0F2BP02 Q6MT00
gi|479184184|ref|YP_007811437.1| 272632.MSC_0616 NP_975596.1.55851 WP_011166792.1.11018 WP_011166792.1.17500 WP_011166792.1.32010 WP_011166792.1.3214 WP_011166792.1.37196 WP_011166792.1.51345 WP_011166792.1.72634 WP_011166792.1.84266 gi|42561145|ref|NP_975596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]