SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184191|ref|YP_007811592.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184191|ref|YP_007811592.1|
Domain Number 1 Region: 77-280
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.88e-40
Family Pseudouridine synthase RsuA/RluD 0.001
Further Details:      
 
Domain Number 2 Region: 15-63
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000383
Family Pseudouridine synthase RsuA N-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184191|ref|YP_007811592.1|
Sequence length 302
Comment pseudouridine synthase, RluA family [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MTKFVVNKNDQNQTLFKFLKKTFKTTPISVIYKWIRNKSIKINSKRISDKNYLLKVNDII
EVYDSNKPIIRDQFNYISNVNLDIIYEDNNILIVNKPNNLEMHSTYNLCLDDMVKSYLVD
KKEYDIYLENSFVISHVHRLDKLTSGLVIYAKNKISSTILTNAFKLKDQINKYYYALTSC
DWNLDEFLQVNGYINYDSNIKRAHFSLDQKNNYKYCQTEFKLINKNLILVKLITGKKHQI
RSVLSFYNHPILNDFRYNGKKINDLKMIYLSAFKIEFKNLEKPLDYLNNKVFIKNPEWIS
KE
Download sequence
Identical sequences A0A0F2BH56 Q6MSK6
272632.MSC_0766 gi|479184191|ref|YP_007811592.1| gi|42561291|ref|NP_975742.1| NP_975742.1.55851 WP_011166934.1.11018 WP_011166934.1.17500 WP_011166934.1.3214 WP_011166934.1.37196 WP_011166934.1.51345 WP_011166934.1.72634 WP_011166934.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]