SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184211|ref|YP_007811076.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184211|ref|YP_007811076.1|
Domain Number 1 Region: 127-461
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.94e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000678
Further Details:      
 
Domain Number 2 Region: 471-587
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.09e-40
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000347
Further Details:      
 
Domain Number 3 Region: 2-80
Classification Level Classification E-value
Superfamily Single hybrid motif 5.63e-21
Family Biotinyl/lipoyl-carrier proteins and domains 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479184211|ref|YP_007811076.1|
Sequence length 595
Comment dihydrolipoyl dehydrogenase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MFKVKFADIGEGLTEGTVAEVLVKVGDVVKEGQPLYFVETDKVNSEIPSPVAGKIAIINI
STGQEIKVGDVVIEIDDGTSVSTSEPKVEVVEENASVVGATPVSNDVLPSRAPKPKPEAP
KVDVQIEDTFDVCVVGAGIGGYVTAIKSAQLGLKTLIIEKEYYGGVCLNVGCIPTKTLLK
TSHVYHDIMHKAKELGIVLQNTEKVVIDWAQVLQRKNGVVKKLTGGVKYLLDKNKVTQIK
GEAVALDKNTISVNNKNYRVNNLIIASGSTPNHLPLPGFDQGRKDGIIIDSTGILSVPKI
PETLVVIGGGVIGIEFSCLFASLGTKVTVLQGLPTVLEMLDKDIIDAMTKELKNRYNIEV
ITNASVKEFKNGSVVYEIDDKDQMIKGEYVLESVGRKTSITGFENIGLELTPRKAIVVNE
YQETNLDGVYAIGDVVGKVMLAHTAVKGAIVAANRIAKKANKDHAEDIVMDYYRIPSCIY
THPEVSMIGKTEQQLKQENIEYKTFKFPFSAIGKALADNDTSGFVKIIIEPKYKTILGAH
IIGNRATEMISEIAAVIECEGTITEIANTIHPHPTMSEAIGEAAEALETGKAIHF
Download sequence
Identical sequences Q6MTX7
gi|479184211|ref|YP_007811076.1| gi|42560816|ref|NP_975267.1| 272632.MSC_0268 NP_975267.1.55851 WP_011166465.1.17500 WP_011166465.1.32010 WP_011166465.1.3214 WP_011166465.1.37196 WP_011166465.1.51345 WP_011166465.1.72634 WP_011166465.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]