SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184253|ref|YP_007811067.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184253|ref|YP_007811067.1|
Domain Number 1 Region: 6-224,323-371
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-43
Family FAD-linked reductases, N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 226-319
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000889
Family D-aminoacid oxidase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479184253|ref|YP_007811067.1|
Sequence length 387
Comment FAD dependent oxidoreductase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MKQTKVDICIIGGGIIGASVARELAKFDKKIVVLEANPRLALETSSHNSGLVHGGFDPRP
ETLNAKLNVLGKKRYEDWIKEMDFPYLRIDSTIVAFNDEEMKHVHMLYDRGLINGLDPKE
MQVIDAKELQKREPNISKQAVGALVCNSSIAIDPVLLTTTLMRNAIKNGVELKVNSKVVD
IKKVDNIFEIKTAKDEIIQAEVVVNVAGHYADVIANMAGYGDFKLTTRRGEYRILDKSEA
GIVNSVVFMVPTIHGKGVIVAPMLDGRVMVGPTALDGVPKEETLLVTQQQYDNIGKIGKH
LIPNINMDKTCTVYAGSRPIDIETNDFIIRPAKNDKKFINVAGMKSPAIASAPAIADMVC
DLVKNAFDKLDKKANWQPKEEAILPWK
Download sequence
Identical sequences A0A120KTR6 Q70GP9
gi|479184253|ref|YP_007811067.1| WP_015545438.1.11018 WP_015545438.1.17500 WP_015545438.1.32010 WP_015545438.1.51345 WP_015545438.1.72634 WP_015545438.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]