SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184344|ref|YP_007811161.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184344|ref|YP_007811161.1|
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 6.67e-33
Family Transcription factor NusA, N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 205-283
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.86e-26
Family Prokaryotic type KH domain (KH-domain type II) 0.00012
Further Details:      
 
Domain Number 3 Region: 284-345
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.000000000353
Family Prokaryotic type KH domain (KH-domain type II) 0.0011
Further Details:      
 
Domain Number 4 Region: 132-204
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000172
Family Cold shock DNA-binding domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184344|ref|YP_007811161.1|
Sequence length 584
Comment transcription termination factor NusA [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MLNGTELLESIKLIEKEKGISKESIINGLKEGLQKAYERFYDTDAIIKIDINENTGLITM
HQELKVVDDEQLDDDWLEITLSKAKLKNPDIQIGDTIYKPIEFSEEFSRMVVNQVRQIFQ
QKIREAERARIYEQFVSLEGEVVQAKIVGMNRENNYVLDINGTTAYLWKSKTINNEIFQI
NEIIDVYIEVVEKESKLSQISISRTAPNFLTKLIEREVPEVRMGIVEIKAVSREPGKRSK
VAVITHNNNVEPIGAIIGVGGNRINRISDILKGEKIDIIRWDEDQITYLINAMTPVKVIS
INKIGDEYDIVVPDTQLSLAIGKQGVAAKLIASLLKTKINIFSYSTALKENMDILWNGDT
TKQEVETNTYIPKTKTTKKEEKPVITTIKKPVKQTIKKEENQIDVDALIAFQAEVEHEQE
LKDQEELLKQEYIYKEYENNFNDFENEKEIVLAEKQLESQNQIIKEPVVEVQEVEIEKQS
KTEDQIIENKQPETRTEVETKPNTVEQVNKLNTNKPNNKFEQNRFSYKKQKQKEEELELG
FDIKNEPDIDEIDANLKAFNDAILKQEDDEDLDIDLDDYDKYYD
Download sequence
Identical sequences WP_015545475.1.51345 gi|479184344|ref|YP_007811161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]