SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184348|ref|YP_007811506.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184348|ref|YP_007811506.1|
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.57e-29
Family N-terminal domain of MutM-like DNA repair proteins 0.00072
Further Details:      
 
Domain Number 2 Region: 134-224
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.62e-26
Family Middle domain of MutM-like DNA repair proteins 0.0024
Further Details:      
 
Domain Number 3 Region: 223-273
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000024
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479184348|ref|YP_007811506.1|
Sequence length 274
Comment DNA-formamidopyrimidine glycosylase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MPELPEVVTVTNTIKPKIINRTILNSQIFTNKIISSTNVDQFINLTKNQKIYDVYNLAKY
IVIELKEHVIISHLRMTGKWVIENSDQYAYKKSWLRAELLLDNNLVFRFYDMRGFGTLNL
YNKQTFLKDSHLDKLGPIPLNNQTSADYLFNKLQKSNKAIKTVLLDQHVISGLGNIYVNE
VLFLSKINPLVSANLITKDQTKEIIKNCETVLSQAILLKGTTISDFESLPGITGGYQTKL
LVHMNNKNCKICDTKISKIKVNGRGTYYCSKCQN
Download sequence
Identical sequences Q6MST7
272632.MSC_0682 NP_975659.1.55851 WP_011166853.1.17500 WP_011166853.1.32010 WP_011166853.1.3214 WP_011166853.1.37196 WP_011166853.1.51345 WP_011166853.1.72634 WP_011166853.1.84266 gi|42561208|ref|NP_975659.1| gi|479184348|ref|YP_007811506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]