SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184358|ref|YP_007811733.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|479184358|ref|YP_007811733.1|
Domain Number - Region: 213-274
Classification Level Classification E-value
Superfamily IHF-like DNA-binding proteins 0.00219
Family Prokaryotic DNA-bending protein 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184358|ref|YP_007811733.1|
Sequence length 335
Comment conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MSKKPSSKGHLLVARMFLGLFFVSFVIIFILKLVNVSKTNGKIGLDFMTALTGFGVTLAK
PIKWGEGLDEFCNIAFITWIPLILIVSLIFYILYYKNLVKTIQVEDSTTKVDITIKTEGD
VIVESETEEQPMKKEEIMVVEQLPMSEPEPQPEPIVEAEPMMSEPELVIEPAPMISEPEP
KPDPVVIPAPMMSEPEPKPAKKRKKKKTYPQVTKGMLLDELYEDPEFIEMTKVSIKTIFD
KTFIVASKNLVAGDHVVLAKFVNLKQLKKKLKWRWILQHKNKSKFLHIKLLNLNYQNLLK
KKWMNKDKNGKYAIAIFYLFYFWYMIIIVLKGIYV
Download sequence
Identical sequences gi|479184358|ref|YP_007811733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]