SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184359|ref|YP_007811013.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184359|ref|YP_007811013.1|
Domain Number 1 Region: 12-41
Classification Level Classification E-value
Superfamily IHF-like DNA-binding proteins 0.000000559
Family Prokaryotic DNA-bending protein 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184359|ref|YP_007811013.1|
Sequence length 43
Comment conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MNKKELISEIFFKRKTGEQIIIPASKTAKFKPAKKLKELLTEQ
Download sequence
Identical sequences A0A0F2BM04 Q6MU31
gi|479184359|ref|YP_007811013.1| gi|42560762|ref|NP_975213.1| 272632.MSC_0210 NP_975213.1.55851 WP_011166412.1.11018 WP_011166412.1.17500 WP_011166412.1.32010 WP_011166412.1.3214 WP_011166412.1.37196 WP_011166412.1.51345 WP_011166412.1.72634 WP_011166412.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]