SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184369|ref|YP_007811540.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184369|ref|YP_007811540.1|
Domain Number 1 Region: 4-250
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.45e-53
Family Pseudouridine synthase I TruA 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184369|ref|YP_007811540.1|
Sequence length 251
Comment putative tRNA pseudouridine synthase A [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MKTGILLSLCYDGSNYHGWINQTNAISIQTTLNKAIKKVIKTGQFKTIGASKTDTNVHAL
DQKVLLIIYFTPILEKFIKAINKALPSDIKILDAKFVDPNFNIREVEYKIYHYYINDHQF
DIFTNRYEYFWKHQKIDIIKLQEIFNLFIGEHEFKLFSGLKENEWNQYQTKRTIDDIKVL
RINNKVVIEFKASGFIRYQIRIIIANCLNAYLNHKISTTKLVEMLQGIGKKTPFIIDAKG
LVLQKIQFNKN
Download sequence
Identical sequences A0A109WM75
gi|479184369|ref|YP_007811540.1| WP_015545486.1.11018 WP_015545486.1.17500 WP_015545486.1.32010 WP_015545486.1.3214 WP_015545486.1.51345 WP_015545486.1.72634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]