SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184384|ref|YP_007811534.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|479184384|ref|YP_007811534.1|
Domain Number - Region: 109-136,293-428
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0262
Family Multidrug efflux transporter AcrB transmembrane domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184384|ref|YP_007811534.1|
Sequence length 520
Comment putative membrane protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MKKTVKLTIILLVVAVIYFGYSAWLDGVAIYAIRGVKNDGKDSFFSLMTSTSAWVNNWKT
ILIEKLGESSEWGKKVAAFNGSTSWTDWVNAINQSGYKLTGFMAPDSLLYTLLSPFKLIL
VGGVFAMFIPLLKQLLFNTIIGIKSYLKNRDMNVLFNYSKTIEFVENLKTKISEGDFEGV
KTAYSSYSSLAFKPVFLTNLMNEIYKTLIKFGDVTVFKNGCISVLESIQEMYLKEKRRAM
NNGRGDEMFYDIKRGFEYSSYSSRYFVKYYEAMSKDFKKLGWKIFSIEISRFSLFLLFAL
LPSILLSGIISGILLKLITENSSNITALVTIGSFIMLWVIFAIIFHGFYIFFKKDYKINK
HILIKPAITYYSLLLLAFMTLTAGCVGIAQVGNIAQPFTAPLMTKWFGALAYLVLTTCLV
MYALATLVDNYRSGKQLSVKLIVNNIVLPGFIWTITTGANFVALFAKSEQVMEYSSLISG
INTLVMVIFWIYLFTAQFLINNLITSKTAKILKQTKVIQK
Download sequence
Identical sequences A0A0F2BME1
gi|479184384|ref|YP_007811534.1| WP_015545496.1.11018 WP_015545496.1.17500 WP_015545496.1.32010 WP_015545496.1.3214 WP_015545496.1.37196 WP_015545496.1.51345 WP_015545496.1.72634 WP_015545496.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]