SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184540|ref|YP_007810935.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184540|ref|YP_007810935.1|
Domain Number 1 Region: 37-118
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000000251
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184540|ref|YP_007810935.1|
Sequence length 180
Comment conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRFEAFGIEGLINKEKKP
YYSAKLKLKIVLYKLETNHSYDEVAKKFNIIFSSTIAGWVKKYREYGFLGLNNNIGRPKK
IMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLKAEFWKKFHTLLTKEKSTRKKQK
Download sequence
Identical sequences A0A126SSP4
WP_015545556.1.11018 WP_015545556.1.3214 WP_015545556.1.51345 WP_015545556.1.72634 WP_015545556.1.84266 gi|479184540|ref|YP_007810935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]