SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184548|ref|YP_007811102.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184548|ref|YP_007811102.1|
Domain Number 1 Region: 12-95
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 1.83e-22
Family GIY-YIG endonuclease 0.0058
Further Details:      
 
Domain Number 2 Region: 181-233
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00000000000235
Family C-terminal UvrC-binding domain of UvrB 0.0063
Further Details:      
 
Domain Number 3 Region: 527-584
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000731
Family Excinuclease UvrC C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479184548|ref|YP_007811102.1|
Sequence length 584
Comment excinuclease ABC, C subunit [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MSLKQQVDLLPNKPGCYLFFNKDNDVIYVGKAKNLKKRVSTYFNKAYNIKTTRLVREITD
LKYFIVDNEKESLLLEKNLIKKYHPKYNVLLNDDKTYPYIIITNQKDPMYKYVRKYDKKA
LKNYGPLPIGSNARSILLTLQRLFPLRMCQGNLNKPCLYYHLNQCSGACFKQVDPSYYEY
QIKQVDKFFKGEINQVKQTLVKQMQKASDNLQFEQAQRIKDQITSLDFITAKQNVDIVTN
KNIDVVNYEINQDKICFVILFYRLGQLTYKDEYIQNYEGQNLSELFNSYLQQIYQKNIYP
DVLLIPNEIELLDLDQNLLEFSSYSLNKQDDVFIKLAKQNAIDSLNKSVISHNVNSGDEI
EILEQLKQISNASKYLKRIEVFDISNIYSQFITGACIVYINAKPIRNEFRKYNIDPSYTS
DFSRMKFMLEKRFLKQIKEKEQLPDLVIVDGGIIQIHAAKEVLNKLNLKIDVIGLSKDDH
HKTRYLIDIFEQTIDIKNFKKLYNFLTSLQIRVDEYAKSGFRKKYHNQLNDQILLIKGVG
KKTNLKLYKHFKTIDNIKNASFDELNKVINNKKITNLIISNLNK
Download sequence
Identical sequences A0A0F2BG17 Q6MTU8
gi|42560845|ref|NP_975296.1| NP_975296.1.55851 WP_011166494.1.11018 WP_011166494.1.17500 WP_011166494.1.32010 WP_011166494.1.3214 WP_011166494.1.37196 WP_011166494.1.51345 WP_011166494.1.72634 WP_011166494.1.84266 272632.MSC_0297 gi|479184548|ref|YP_007811102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]