SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184589|ref|YP_007810784.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184589|ref|YP_007810784.1|
Domain Number 1 Region: 57-271
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.12e-32
Family Extended AAA-ATPase domain 0.0000164
Further Details:      
 
Domain Number 2 Region: 293-396
Classification Level Classification E-value
Superfamily TrpR-like 6.54e-31
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184589|ref|YP_007810784.1|
Sequence length 399
Comment chromosomal replication initiator protein DnaA [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MLAIKQFRQTIKNEIKNILKEPVNISFTYEQEYKKQLEKDELIKKDHSDIITKKVKKINE
NTFENFVIGASNEQAFIAVQTVSKNPGISYNPLFIYGESGMGKTHLLKAAKNYIESNFSD
LKVSYMSGDEFARKAVDILQKTHKEIEQFKNKICQNDVLIIDDVQFLSYKEKTNEIFFTI
FNNFIENDKQLFFSSDKSPELLNGFDNRLITRFNMGLSIAIQKLDNKTATAIIKKEIKNQ
NIKSEVTSEAINFISNYYSDDVRKIKGSVSRLNFWSQQNPEEKIITIEIVSDLFRDIPTS
KLGILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHIAMFLTKEILNHTLAQIGEEF
GGRDHTTVINAERKIETMLKKDKQLKKTVDILKNKILTK
Download sequence
Identical sequences gi|479184589|ref|YP_007810784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]