SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184605|ref|YP_007811292.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184605|ref|YP_007811292.1|
Domain Number 1 Region: 519-670
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 6.28e-19
Family Multidrug efflux transporter AcrB transmembrane domain 0.0088
Further Details:      
 
Domain Number 2 Region: 1076-1158
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0000432
Family Multidrug efflux transporter AcrB transmembrane domain 0.019
Further Details:      
 
Weak hits

Sequence:  gi|479184605|ref|YP_007811292.1|
Domain Number - Region: 1301-1355
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.000301
Family Multidrug efflux transporter AcrB transmembrane domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184605|ref|YP_007811292.1|
Sequence length 1384
Comment putative membrane protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MKNRLASFKKVLRFIIVLILILALLTGIGFSSYKISNNISYGAKFVGGYQALVGVYDKTK
NQEEEIPNGDAFKGAQSLEKKLSPFSDNTIETQQSGLSRVFIKASKKAYANNQDDFKNAI
ERTGGLLILDKNYQDIFFNENLMKIIGIDKVYDSSSDKRVAKKLTLEEFLGEAKAESLQP
ANFSNKNSPFVSFNLKNEYLKNLIDPKKNKDNNALTMITSVGHIIENLRTYYKKANSTNN
QVVEQYLNTYFNQIIKPIQDYISSKASSDQLGVKILKDLFTIEYSVPTTEGSQKNLSIQR
NSLVDSNIVKWWNSNTKGKIDNTKNLKYVLFGTDNLNNKKSDHIFRFTNSANKYIYDANA
SEKDFIKDDKGNVGKYYNKLKISSDNSTSQDIELDYIDKVSNSLIKILMTEILFKKDTTD
KDHIVNKNLDQNLFRNNILLHNNQISPENIRIVTTNPAIVIDRKTQTTKLYIPVWSNTMA
KQVESDILQTSLGFTFKVLSIKEFSADITNIMLIITLACLVILALAVLVFMLFSYRLLGL
FAIILAAISASLTMFAPIIFNMAIGPEIFMIIFVGIGLILDASIIYFENLKTHIYKEKLS
PESSFKISNKDTLPISLDTSFIILIPSVLLFIFGSGALKNLATISVINILIIILFVILGL
RLLTWLVLKAKLFTKYPWLLPLNTIKNSQSTWFNDLMLSFYLSRIENLNTKTKLTAKDLA
KLKKFKDKYDFYLNKQEQIITNKKLKQLKKDQYNLELVNKRLLKLENKYEIYLNKQEQIN
NNKKAKLLKKKKSEEIKNKCLLKLENKKQKIINKNSFTKSSIKNSLIKQEFLQARINKNT
SSQVLETLENKNKQRRIFKINKIFTIIFIICTFLGAIIGITIGPNYNSSFGKSYSVIAYG
QKINDIYDNLDEAIRNYKQFDPSTKRGKDIISMGEHLEKVKNSQDAYMKSKFKVDYSNLT
KPSDKNQWASYVVGNIYKEIVKKNYVSLWKNPVSYNKYFRASVDVDYGYDFIDTNSLNLD
HKQLAYVGFNIINAQDNKIISIFEKLLVKDNLQNPDLSIKYDHDDNSSANGIINLINVPY
TAYGEIKNIAIIFAITLLALLVYILIRFKWTYFVALALTLILVIVLVSSLVVIFRVPVGI
EILSAILAVLSFTIITCVLFLGKGKSIIKSKDNKTFTEMFEKEIMAFSNKKATRHQVHEK
KYQLKVEYKTNKKNLIKQQLESNNIKSLWSKMFFKLKQNIKLRFNKKHNSLYKDFKLKIK
ENKNILKHHKKHTKIEIDLIANNNAFLKETFINVFKFGMTRTILITVIYLAYAIILSFGL
YAIIGMGLTIIIGILISSLVSLLIALPIWIWLEKKCMIYVLGYRYYVQNFKINQEEQIIN
GIND
Download sequence
Identical sequences gi|479184605|ref|YP_007811292.1| WP_015545582.1.51345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]