SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184696|ref|YP_007811612.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184696|ref|YP_007811612.1|
Domain Number 1 Region: 37-118
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000000105
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479184696|ref|YP_007811612.1|
Sequence length 180
Comment conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRFEAFGIEGLINKEKKP
YYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYREYGFLGLNNNIGRPKK
IMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWKKFHTLLTKEKSTRKKQK
Download sequence
Identical sequences A0A0F2BKT6 Q6MSC6
NP_975651.1.55851 NP_975822.1.55851 NP_975867.1.55851 WP_011166845.1.11018 WP_011166845.1.17500 WP_011166845.1.32010 WP_011166845.1.3214 WP_011166845.1.37196 WP_011166845.1.51345 WP_011166845.1.72634 WP_011166845.1.84266 272632.MSC_0674 272632.MSC_0851 272632.MSC_0898 gi|479183947|ref|YP_007811675.1| gi|479184123|ref|YP_007811499.1| gi|479184342|ref|YP_007811725.1| gi|479184421|ref|YP_007811346.1| gi|479184676|ref|YP_007811177.1| gi|479184696|ref|YP_007811612.1| gi|42561200|ref|NP_975651.1| gi|42561371|ref|NP_975822.1| gi|42561416|ref|NP_975867.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]