SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184698|ref|YP_007811566.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184698|ref|YP_007811566.1|
Domain Number 1 Region: 110-209
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 1.44e-32
Family Ribosomal protein S3 C-terminal domain 0.0000494
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.66e-29
Family Prokaryotic type KH domain (KH-domain type II) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184698|ref|YP_007811566.1|
Sequence length 233
Comment ribosomal protein S3 [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MGQKVSPNVLRLGIVRDWENRWYAEKDQYVKWLDQDIKIRTALFKLLKDAAVSKIDIERT
TKDLTLFIKTARPAIVLGQEGKNIEKIVLAVRKTVKNKKLIVNVRVIEIKSPDADATLVA
RWIGEQISNRASFRTVQKLAIKKALKAGAKGIKTAVSGRLGGVEMARTEGYLEGSVPLST
LRNNIDYALYEAPTTYGQIGVKVWINHGEVFKKERMNNSQIMAKPRTNKGGKR
Download sequence
Identical sequences A0A014L5E4 A0A078KP44 A0A084EJQ0 A0A0C3A114 A0A0F2BGY7 A0A1D5B5D1 F4MQN6 P02353 Q6MSN1
gi|42561264|ref|NP_975715.1| gi|479184698|ref|YP_007811566.1| gi|83319775|ref|YP_424654.1| 272632.MSC_0739 340047.MCAP_0690 gi|331703710|ref|YP_004400397.1| NP_975715.1.55851 WP_011166907.1.11018 WP_011166907.1.17500 WP_011166907.1.19789 WP_011166907.1.28854 WP_011166907.1.29233 WP_011166907.1.32010 WP_011166907.1.3214 WP_011166907.1.32284 WP_011166907.1.32760 WP_011166907.1.37196 WP_011166907.1.3902 WP_011166907.1.51242 WP_011166907.1.51345 WP_011166907.1.58029 WP_011166907.1.63188 WP_011166907.1.65728 WP_011166907.1.66603 WP_011166907.1.71627 WP_011166907.1.72634 WP_011166907.1.77628 WP_011166907.1.826 WP_011166907.1.84266 WP_011166907.1.84933 WP_011166907.1.90090 WP_011166907.1.98664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]