SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184725|ref|YP_007811308.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184725|ref|YP_007811308.1|
Domain Number 1 Region: 194-396
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-44
Family Nitrogenase iron protein-like 0.00000417
Further Details:      
 
Domain Number 2 Region: 97-170
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.0000000000183
Family Domain of the SRP/SRP receptor G-proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479184725|ref|YP_007811308.1|
Sequence length 412
Comment signal recognition particle-docking protein FtsY [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MGFWAKLKEKLTKKTNQVEQDEPILDQQDQQDQQEEQEQIIEKEIEQEPVVNQDKQVEII
KENKIKKTKTSETKKQEKPIETLKEKKKREKQKEKDKKVEKAMLKSAFNFSKDIKKLSKK
YKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTD
NDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGA
TQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKVN
LMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTS
KGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVHLSSGFMQGDEVEK
Download sequence
Identical sequences A0A126SRV2
gi|479184725|ref|YP_007811308.1| WP_015545633.1.11018 WP_015545633.1.51345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]