SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184735|ref|YP_007811298.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184735|ref|YP_007811298.1|
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily RNase III domain-like 1.62e-45
Family RNase III catalytic domain-like 0.000096
Further Details:      
 
Domain Number 2 Region: 111-229
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.04e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184735|ref|YP_007811298.1|
Sequence length 232
Comment ribonuclease III [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MNIKNFFEKYNIKINNEKLFNEALTHNSYANEHKLKYSYQRLEFLGDAILQMYVSRFLFF
NYSKLSEGELTRLRASTVREETLFRVAKDINLGALVKLGHGEYITKGYEKPSILADVFEA
LTAAIYLDQKEDGLVTWLGQTLFKYIKDSNFINDTKDFKSELQELLQSEKRSDLKYIIEK
EDFFANENKILYTVSVNLNGQKFGVGKGFSKQEAEQNAASDCLSKLKKPTSN
Download sequence
Identical sequences A0A0F2BK89 Q6MTC9
gi|479184735|ref|YP_007811298.1| 272632.MSC_0479 NP_975465.1.55851 WP_011166663.1.11018 WP_011166663.1.17500 WP_011166663.1.32010 WP_011166663.1.3214 WP_011166663.1.37196 WP_011166663.1.51345 WP_011166663.1.72634 WP_011166663.1.84266 gi|42561014|ref|NP_975465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]