SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184744|ref|YP_007811365.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184744|ref|YP_007811365.1|
Domain Number 1 Region: 3-323
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.36e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00038
Further Details:      
 
Domain Number 2 Region: 329-443
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.58e-26
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184744|ref|YP_007811365.1|
Sequence length 452
Comment pyridine nucleotide-disulfide oxidoreductase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MQKFDVVVLGAGPGGYSLANILSLNNKKVALIEKEDLGGTCINKGCVPTKTLIKSAKVFE
LVKNSQKFGINADNISFDFKKMQQRRLDNKKFFNNSIKNQIDLNQISFFKGVGEVLDQNS
IKVNDQIISFDKLVLATGTRAKIINFDGLEQSRKNGYLLDSDQALFLENVPSSLTIIGDG
PISLEFAYLYNTLGSKVTILTNTDFLLRFDIDIQKSVRQYFDEKQIKVIENANIIKIDNN
KVFYDQTSIESEKILLAVGRVPNNESFTKLDIKKDKNGFVIVDEFMKTNFDNIYAIGDIT
GLTLLSSVAYKTGDIVARNILKTDSEKFDKNLVTWAIYLNPEIAGIGLTEQQLKEQNIEF
ESIMINSKALPRAHADGIVNEYSFIKFLVSKQTEEILGCFMMIENANILINQIGLFMQQK
LSFSTLQKTVYTHPTIGEALYYTSRVKGIKTN
Download sequence
Identical sequences A0A0F2BNF5 Q6MT66
NP_975528.1.55851 WP_011166726.1.11018 WP_011166726.1.17500 WP_011166726.1.32010 WP_011166726.1.37196 WP_011166726.1.51345 WP_011166726.1.72634 WP_011166726.1.84266 gi|42561077|ref|NP_975528.1| gi|479184744|ref|YP_007811365.1| 272632.MSC_0544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]