SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184747|ref|YP_007811225.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184747|ref|YP_007811225.1|
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily IHF-like DNA-binding proteins 1.62e-27
Family Prokaryotic DNA-bending protein 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184747|ref|YP_007811225.1|
Sequence length 90
Comment DNA-binding protein HU [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MTKKELIEEIIINENISKVDAEKVVNRIFQTISKHLIEGKEVSVAGFGKFVISERSSREG
VNPSTGEKIIIPASRSARFKPAKQLKESLM
Download sequence
Identical sequences A0A078MZE3 A0A084EM53 A0A0F2BKV0 A0A1D5B4V0 Q2SRR9 Q6MTJ4
gi|392389050|ref|YP_005907459.1| NP_975400.1.55851 WP_011166598.1.11018 WP_011166598.1.17500 WP_011166598.1.19789 WP_011166598.1.23723 WP_011166598.1.28854 WP_011166598.1.32010 WP_011166598.1.3214 WP_011166598.1.32284 WP_011166598.1.32760 WP_011166598.1.37196 WP_011166598.1.51345 WP_011166598.1.65728 WP_011166598.1.66603 WP_011166598.1.71627 WP_011166598.1.72634 WP_011166598.1.77628 WP_011166598.1.826 WP_011166598.1.84266 WP_011166598.1.90090 gi|479184747|ref|YP_007811225.1| gi|42560949|ref|NP_975400.1| 272632.MSC_0410 340047.MCAP_0575 gi|83320061|ref|YP_424544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]