SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184749|ref|YP_007811294.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184749|ref|YP_007811294.1|
Domain Number 1 Region: 19-205
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.2e-61
Family HD domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 197-413
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.09e-50
Family RelA/SpoT domain 0.0000274
Further Details:      
 
Domain Number 3 Region: 400-468
Classification Level Classification E-value
Superfamily TGS-like 2.29e-19
Family G domain-linked domain 0.065
Further Details:      
 
Domain Number 4 Region: 670-746
Classification Level Classification E-value
Superfamily ACT-like 0.00000641
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479184749|ref|YP_007811294.1|
Sequence length 750
Comment putative GTP diphosphokinase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MHNKYNYISFDYREIKDFKDLLNELKKYIKNKSELERIEQAYKYAFKCHFNQTRKNGDPY
IYHPLSAAYYLAQWRMGPNTIIAGLLHDILEDTPIQKEELVELFNEEVANLVESVTKVSF
FAKENRQQIKSKYLRKLYLSMSKDIRVIIIKIADRLHNIYTIKNLRSEKQKIIAQETLEI
YSAIAHRIGMKSAKSLLEDRSFEILNPQEFKKITDLFNSDMQNRQQIINDIIINLEQYLK
KEKNIKIISIFGRPKTIYSIYRKMNVIGKNFEEISDLLAIRIIAKSIDDCYKILGFIHQK
YIPLAGKFKDYIATPKNNVYQSLHTTLSDANGNIFEVQIRTEEMNQVAETGAAAHWRYKE
GEIIDIAKKQKEIDEKIDIFSRILDLDKSEDQQSSIEQSIKDDLFTASIYVLTPNGAVIT
LPYGSTVLDFAYRIHTEIGEKTIGARVDGVFLPINTVLKSGEVVEVKTSPKQEPTHEWLK
IVVISNARNRIKKYLQKKINEETLDKKDQQKELIRKTEANINAYINQKDWKWKKKTADEI
LETVKTMDYNSLNDFLLDVAKGEFTINEAAEKVFIKQNYSKDDEAYASIKSKIIYDTTIK
NDILVDGIKNIKTTLASCCMPIPYEEVVGFVTKNNGIKVHLKECINIDWTNMKSRLVVVQ
WNEAVAEKNTYTTKLKYFGIDRNKLLYDISKIISGLKVSIINANIFTDEKSLLSSGVITI
KIKNSNQLTQTISALRSIPGINGVERGISN
Download sequence
Identical sequences A0A126SRQ4 Q6MTD3
NP_975461.1.55851 WP_011166659.1.11018 WP_011166659.1.3214 WP_011166659.1.37196 WP_011166659.1.51345 WP_011166659.1.84266 272632.MSC_0475 gi|479184749|ref|YP_007811294.1| gi|42561010|ref|NP_975461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]