SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184750|ref|YP_007811050.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|479184750|ref|YP_007811050.1|
Domain Number - Region: 4-61
Classification Level Classification E-value
Superfamily TrpR-like 0.000235
Family Trp repressor, TrpR 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184750|ref|YP_007811050.1|
Sequence length 67
Comment conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRFEAFGIEGLINKEKKP
YYPTFPT
Download sequence
Identical sequences gi|479184750|ref|YP_007811050.1| WP_015545640.1.17500 WP_015545640.1.32010 WP_015545640.1.3214 WP_015545640.1.37196 WP_015545640.1.51345 WP_015545640.1.72634 WP_015545640.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]