SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184794|ref|YP_007811793.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184794|ref|YP_007811793.1|
Domain Number 1 Region: 18-122
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.83e-23
Family N-utilization substance G protein NusG, N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 154-210
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000000142
Family N-utilization substance G protein NusG, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184794|ref|YP_007811793.1|
Sequence length 213
Comment NusG family protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MTYEEIKQLEDEILEAKGQWFVISCQTGHEEKVLGDLQQKIKSASIEDEVFSIKISKANL
VSKSGKSSIKNKFPGYIFINMIMSEKAWFLIRNTPGVTGFIGSSGRGAKPSPLTTEETLN
ILVPNLEEIEQAHKQEQQEENLKNEAVNKKELFTANFKVGDVVRVKSGIHENEEGTVKDM
DFSKGVAFVAIEMFGRWTTLEVSFKNVEPIKEY
Download sequence
Identical sequences A0A0F2BK61
WP_015545656.1.11018 WP_015545656.1.17500 WP_015545656.1.32010 WP_015545656.1.3214 WP_015545656.1.37196 WP_015545656.1.51345 WP_015545656.1.72634 WP_015545656.1.84266 gi|479184794|ref|YP_007811793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]