SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184813|ref|YP_007811313.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184813|ref|YP_007811313.1|
Domain Number 1 Region: 1-147,291-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.46e-17
Family Thi4-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184813|ref|YP_007811313.1|
Sequence length 438
Comment tRNA:M(5)U-54 methyltransferase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MNKKVKIIGAGLAGCEAAYFLANNNIQVELYEVKTLIKNEVQKTNNFAELVCFNTFRSQS
LLNAAGILKAEMRRLNSLVIKIADGCKIDGDDALAVDREDFSKKLTEVIKNHPNITIIEQ
NVSHIDDENDLTLIATGPLTTNELKEDIQRLIGKQKLFFIDASASIITKDSIDFNKVYYS
GRHKLGKYICCPLNEQEFNEFADNLINAEQVQLKEFEKSIFFKGCQPIEQLAKTSKKLLL
KGPMSPNNLLDQNNHQPYSVVQLRQDDAKDSLYNMVGFQTNLKWPEQKRVFQTIPGLEKA
KIVRYGVMHKNYYINSPKILNFKLQVMRKKNVFFAGQITGVEGYIESASSGIWAAINILA
FINNKKIKPLPNTTILGALTNYITNSKIYSLKPMKCNLAILEQENKYQSNDKFYSFNNSK
NSLEEYIKQLNQILGTSI
Download sequence
Identical sequences A0A126SRV7 Q6MTB4
gi|479184813|ref|YP_007811313.1| gi|42561029|ref|NP_975480.1| NP_975480.1.55851 WP_011166678.1.11018 WP_011166678.1.37196 WP_011166678.1.51345 WP_011166678.1.84266 272632.MSC_0494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]