SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184824|ref|YP_007811770.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184824|ref|YP_007811770.1|
Domain Number 1 Region: 6-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.7e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184824|ref|YP_007811770.1|
Sequence length 310
Comment thioredoxin-disulfide reductase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MKNLTNEIYDVIIVGSGPAGLTSAIYTARAGLKTVIYEQSAPGGKLIKTDLIENYPGFET
IQGPDLASKMYLQALSLNASVEFVGVDSIFKNADDIFEISLTNGEIKKAYSVILATGTQE
NKLGIKGEDELYGKGVSYCAVCDGAFYKNKPVAVVGGGYSAVQEAMYLSQLVDKVYLIVR
RDVFRADANKVAKLKAQPNVEFLLKSQVKEIHGAEKVESLTITTPDGEKKLVVSAIFPYI
GSTPLIDSVKHLCIENEKGYIPTNDKMQTEIKGLFVAGDVRDVPLRQIAIACGDGAIAGQ
MAVEYVQEVK
Download sequence
Identical sequences A0A0F2BMR0 Q6MS43
272632.MSC_0938 gi|479184824|ref|YP_007811770.1| gi|42561454|ref|NP_975905.1| NP_975905.1.55851 WP_011167087.1.11018 WP_011167087.1.17500 WP_011167087.1.32010 WP_011167087.1.3214 WP_011167087.1.37196 WP_011167087.1.51345 WP_011167087.1.72634 WP_011167087.1.84266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]