SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184851|ref|YP_007811075.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184851|ref|YP_007811075.1|
Domain Number 1 Region: 188-428
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.23e-79
Family CAT-like 0.00000353
Further Details:      
 
Domain Number 2 Region: 2-92
Classification Level Classification E-value
Superfamily Single hybrid motif 3.4e-22
Family Biotinyl/lipoyl-carrier proteins and domains 0.00064
Further Details:      
 
Domain Number 3 Region: 126-170
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.00000000144
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479184851|ref|YP_007811075.1|
Sequence length 428
Comment 2-oxo acid dehydrogenase acyltransferase (catalytic domain) [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MFKVKFADIGEGLTEGIVAEVLVKVGDVVKEGQSLYFVETDKVNSEIPAPVAGKIAVINI
KAGQEIKVGDVVMEIDEGTGASVASEPKAEAKSEAKVEVVEENASVVGATPVSNDLIVRK
QASTVAKSSTIKATPLARKVAADLNVDLSLVTPTGPNQRILVADIKNYHSSSAQPVSQPA
PAPVVTPTIKVVEPSAPLSWDEVPMNGVRKATVKAMTKSHTEIAAFTGMKNTDITETHKM
RTELKDHAAASGIKLTYLAFIIKAVAKSLRDMPNINVRGDFANNKIQFMHNINIGIAVDT
PNGLMVPVIKGVDHLSVFEIAIKINELANKAKDGKLTRAEMTEATFTVSNFGSVELDYAT
PIINSPESAILGVGAMSQTPLYINGELQKRFIMPLSMTCDHRIIDGADAGRFLIKVQDYL
SKPVLLFM
Download sequence
Identical sequences A0A126SSB6 Q6MTX8
272632.MSC_0267 gi|42560815|ref|NP_975266.1| NP_975266.1.55851 WP_011166464.1.11018 WP_011166464.1.3214 WP_011166464.1.37196 WP_011166464.1.51345 WP_011166464.1.84266 gi|479184851|ref|YP_007811075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]