SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479183952|ref|YP_007811572.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479183952|ref|YP_007811572.1|
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily Translation proteins 1.06e-71
Family Ribosomal protein L3 0.00000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479183952|ref|YP_007811572.1|
Sequence length 223
Comment 50S ribosomal protein L3 [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MKGILGRKVEMTQVFTSAGQLVPVTVVEVLPNTVLQVKTIDSDGYVAVQLGTTDKRVNLV
NKPELGHFKKANSNPKRFVKEIRNMQGYELGQVINVSDIFVSGEYVDVTGISKGKGFAGG
IKRHNYARGPMAHGSGYHRGIGSMGAIINRIFKSKKMPGHMGNAKRTIQNLEIIAIDQPN
NIMLIKGSIPGSKNSFVQIKQNIKGMSSKQAVELLNRNASIEA
Download sequence
Identical sequences A0A126SRA8 Q6MSM6
gi|42561270|ref|NP_975721.1| NP_975721.1.55851 WP_011166913.1.11018 WP_011166913.1.3214 WP_011166913.1.37196 WP_011166913.1.51345 WP_011166913.1.84266 272632.MSC_0745 gi|479183952|ref|YP_007811572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]