SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184264|ref|YP_007811139.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184264|ref|YP_007811139.1|
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.16e-57
Family G proteins 0.0002
Further Details:      
 
Domain Number 2 Region: 402-497
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.82e-23
Family EF-G/eEF-2 domains III and V 0.0085
Further Details:      
 
Domain Number 3 Region: 191-280
Classification Level Classification E-value
Superfamily Translation proteins 1.08e-19
Family Elongation factors 0.0065
Further Details:      
 
Domain Number 4 Region: 295-373
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.6e-19
Family EF-G/eEF-2 domains III and V 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184264|ref|YP_007811139.1|
Sequence length 600
Comment GTP-binding protein LepA [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MDKSKIRNFSIIAHIDHGKSTLADRILELTNTVEKREMQDQLLDSMDIERERGITIKLNS
VQLKYHSKDNQDYIFNLIDTPGHVDFTYEVSRSLAACEGAILVVDASQGVEAQTLANVYL
AIDSNLEIIPVINKIDLPSADVDKVKHEIEEIIGLDCSKSPLISAKTGLNVEDVLQAIVE
KIPSPSDAIDNAPLKALIFDSYYDKYLGVVMSIRLKQGMLKVGDKIKLMSTNAEYEVTSL
GIKTPKIVKKDFLEAGEVGWVAASIKTIKDVNVGDTITSVLNPADEPLDGYKKLKPMVYC
GIYPIDTNKYQDFKEALEKIELSDSSLVYEPETSQALGFGFRCGFLGLLHMEVIQERLER
EYNLELIATAPSVVYKVHLTNKQVIELDNPALLPEAQKISKIEEPFVEIKIATPSEYIGD
LMNLCQNKLGIYKNMEVIDNNRRILIYQMPLAEIIFDFFNKLKSISKGYASFEYELIGYK
ESKLVRMDIKLNGEMVDAFSMIVNQKFAYQRGSALTLKLKELIPRQNFEVPVQATIGNKV
ISRETIKAYRKDVTWKLHAADKSRRKKLLEKQKEGKKKMKEIGTVEVPQEAFVAILKIDD
Download sequence
Identical sequences A0A0F2BKG2
272632.MSC_0330 NP_975328.2.55851 WP_011166526.1.11018 WP_011166526.1.17500 WP_011166526.1.32010 WP_011166526.1.3214 WP_011166526.1.37196 WP_011166526.1.51345 WP_011166526.1.72634 WP_011166526.1.84266 gi|127763383|ref|NP_975328.2| gi|479184264|ref|YP_007811139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]