SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479184294|ref|YP_007811158.1| from Mycoplasma mycoides subsp. mycoides SC str. Gladysdale

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479184294|ref|YP_007811158.1|
Domain Number 1 Region: 110-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.62e-52
Family G proteins 0.0000995
Further Details:      
 
Domain Number 2 Region: 400-530
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 6.8e-31
Family Initiation factor IF2/eIF5b, domain 3 0.0018
Further Details:      
 
Domain Number 3 Region: 525-619
Classification Level Classification E-value
Superfamily Translation proteins 1.77e-26
Family Elongation factors 0.0000428
Further Details:      
 
Domain Number 4 Region: 293-375
Classification Level Classification E-value
Superfamily Translation proteins 3.47e-16
Family Elongation factors 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479184294|ref|YP_007811158.1|
Sequence length 620
Comment translation initiation factor IF-2 [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence
MKKQVKNIKKQKAQNQTKNIKKQLKEEVNTGLIDGIFVYTEPLSVIEFATKINKPLTAIL
KHYFNQGLLLNQNTLLTEEQMGELCLEFGFDFKKETTVTKENILQTLLETVDDEKHLKER
PPIVTIMGHVDHGKTTLLDSIKNSNVVANEAGGITQAIGAYQITTNHNKKITFIDTPGHE
AFTEMRSRGANVTDIVVLIVAADDGVMPQTEEAIDHAKLANVPIIVFINKIDKPEADPNR
VKTELMKYGLVAEEFGGDIPFIEGSAIKKINLDKLQDTIILISELENLKANPDKFASGVV
LEAHLDKAKGPVASVLVQQGTLEIKDIMIAGTTFGSIKHIEDEFKHKVLKAEPSKPVVVY
GLNQVPKAGDKFVVINDEKMAREISEAQLKKQQEEERRTKQAFTLDAIKQHIDEGELKNI
TLIIKADTQGSVEALKNSLSKINISGVKINIIRASVGAISLSDISLASTVRDGLVIVYGF
NVRPDAIVRKKAEEDHIEIKLHNIIYKVIEELEDAAKGILDPEVKELVLGQAQVRALFRH
SAIGTIGGFYVLDGIIPRNAKIRVIRNGVVVYDGEINSLQHQKQDAKEIKAGFEGGLTIK
NFNDIKEEDIFEAYKIEQIK
Download sequence
Identical sequences WP_015545451.1.51345 gi|479184294|ref|YP_007811158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]