SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392403170|ref|YP_006439782.1| from Turneriella parva DSM 21527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392403170|ref|YP_006439782.1|
Domain Number 1 Region: 246-609
Classification Level Classification E-value
Superfamily SIS domain 2.04e-98
Family double-SIS domain 0.000000244
Further Details:      
 
Domain Number 2 Region: 2-232
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.03e-67
Family Class II glutamine amidotransferases 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392403170|ref|YP_006439782.1|
Sequence length 609
Comment glutamine--fructose-6-phosphate transaminase [Turneriella parva DSM 21527]
Sequence
MCGIVGYIGPKSIESVLLVGLQKLEYRGYDSAGMAVLNGDELATRKAVGKIIELEKQLKN
QPILGSAGIAHTRWATHGEPSMTNAHPHLSGHRDIAVVHNGIFENYAKLKAELIDDGHVF
LSETDTEVAPHLMEKYVHEGFSTEEAFVRMLKRVEGQYAVAAISEKDSKKIYFARKGSPL
IIAKGNNEYLIASDIPAVVPIAHEAIYLEEEQWGYISSSGVSIFTLGGEPVPPKWQPVAF
KEEDVDKGDFEYLMLKEIYEQPDVFERILKERLDDTFIHFPELKFGKEYLARVGRILIQA
CGTSLNAGMIGRMYLEQFAHISAETDYSSEWRYRNPLASGDSLVVGISQSGETADTLAGL
REAKAKFMRVLSFLNNINSTMARESDAMISLMAGPEIGVASTKAFTAQVLNLLFFSLYVG
SIKWLMPAEERRTVLDEIRALPDKMRTILKSHERIKEIAEFLKDKNDTIFLGRTYNYPSA
LEGALKLKEISYIHASGYAGGEFKHGPLALVSQNVPVVIIAPQGEIRTKMISNLKEAQSR
GGKIISIITEGDEEIKRESDFYVEIPPCQESISPLLVAVPLQLLAYYTAIARGCDVDRPR
NLAKSVTVE
Download sequence
Identical sequences I4B4R9
WP_014802787.1.12531 gi|392403170|ref|YP_006439782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]