SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392403868|ref|YP_006440480.1| from Turneriella parva DSM 21527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392403868|ref|YP_006440480.1|
Domain Number 1 Region: 262-561
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.22e-65
Family DNA repair protein MutS, domain III 0.0000235
Further Details:      
 
Domain Number 2 Region: 565-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.32e-54
Family ABC transporter ATPase domain-like 0.00000269
Further Details:      
 
Domain Number 3 Region: 10-115
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 8.24e-37
Family DNA repair protein MutS, domain I 0.0000335
Further Details:      
 
Domain Number 4 Region: 118-274
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.000000000000379
Family DNA repair protein MutS, domain II 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392403868|ref|YP_006440480.1|
Sequence length 832
Comment DNA mismatch repair protein MutS [Turneriella parva DSM 21527]
Sequence
MSEVDQKNLDTPMMRQFLEIKKQYPDDILFFRMGDFYEMFLEDAVYAARVLDIALTRRQD
KVPMCGVPYHSMSQYVHPILEQGRRIAICEQLEDPAEAQGRIVRRGVTRILTPGSLFEEA
LIDGKDSRRLCGVTRGKAYWQLAIIEVATGQIWFDRKDDETMAEALAAFGIREWVALDAE
AFTPPAAGILQTRRYPVNDEAFRARVLKDALQTKNLAIWELDVEEACALALALAYLREIS
PVLKMHWSSPQREYRRKSMILDASTLRTLEILASAEGKLNPSLMGLFAHCQTSAGSRLLA
GWLSRPSADHAEIEGRHDAVEILAKHNAYRQLITAELQNVADLERVLTGLSNNPTVRHLG
QVAATLKAIIRLQKIIDDNRMAPFLSRGWQDLREFPVELLQFLEEAILSENLPPLLDSRR
FVKPGYMPLLDEFIELSQNAVKHLTDYEERQKTEHQINTLRVKHNNVLGYFIEISKGQAN
KAPEHFARRQTLTNAERYTTAELKELETKILSAEEEVLRIQKGVFEDIRGQVLAAADQLK
LWAERLARLDVLLAYSHTAVIHRHVRPRMTTEKTLSAESLRHPVIEAYFRSEMFIPNDVH
LNNTDRHLAIITGPNMAGKSTYIRQIGIMQIMAQAGAFVAATSATLPVVDRIFTRIGAQD
RLSHGESTFYVEMAECARIFRNFTADSLILLDEVGRGTSTYDGISIAQAMIESLNDAKTG
RPKTLFATHYSELAHLISQERGIAGLTVSVVEKDGHVVFMRKIVEGVAEKSFGIHVAQMA
GMPKAVTERAAQILKDLEKKSGVIVTSGAAFAQPKTDGRKKKDTQEQAGLFG
Download sequence
Identical sequences I4B6R7
WP_014803480.1.12531 gi|392403868|ref|YP_006440480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]