SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392404612|ref|YP_006441224.1| from Turneriella parva DSM 21527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392404612|ref|YP_006441224.1|
Domain Number 1 Region: 52-407
Classification Level Classification E-value
Superfamily SIS domain 7.37e-71
Family Phosphoglucose isomerase, PGI 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392404612|ref|YP_006441224.1|
Sequence length 416
Comment phosphoglucose isomerase (PGI) [Turneriella parva DSM 21527]
Sequence
MSHEVRFSANKFWMNWQSMGRAQELDALMHAGFRKWPAAFSTDYMKTSELAPLEKWAAEL
RQLDAQTLIVIGIGGSSLGGIALKALIDAHSDRLIFWEGPHPSKMQKIAQIAEQKQTAVL
VVSKSGTTLETRANLSLFRQFFPGVPEYFVTSEPAAIKDLGANSKNTFLIPKDLGGRFSI
VSPVGMMPAMFVDYNVKAFLTAFDEANAEWEISIPVAENVAKQTAIHFYNLFAARFTGVA
FWVYAADLVDWGRWLVQLWAESLGKKPHIAALPMIVQGPEDQHSLLQYFMEASNRHLHCF
VHTQSYGSRDSLISSEIRGDFADKSMSQILNAQMKSIESALSAKERPVAEYMLSDLSETE
MARWFCFWMHVVSYLGYLWEINPFDQPGVEAGKIICKKLLRGENVEEAVQPVFDLR
Download sequence
Identical sequences I4B8W1
gi|392404612|ref|YP_006441224.1| WP_014804219.1.12531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]