SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392401998|ref|YP_006438610.1| from Turneriella parva DSM 21527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392401998|ref|YP_006438610.1|
Domain Number 1 Region: 7-196
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.4e-65
Family Methylesterase CheB, C-terminal domain 0.00000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392401998|ref|YP_006438610.1|
Sequence length 200
Comment CheB methylesterase [Turneriella parva DSM 21527]
Sequence
MNALYHHASKLVAIGASAGGPHAIETVLGELGADMPPILITQHMPEVFTRAFARRLDEIM
ALTVVEADATEKLKSGTVYIAPGDRHLIVRRQGLELFATTDAGPPVNRHRPSVDVLFESV
VSAAPASAMGIILTGMGNDGARGLAAMRHAGFLTIAQDEATSVVWGMPREAVKLEAVDGS
HILPLSKIGPAIKNFVKLPI
Download sequence
Identical sequences I4B1E7
gi|392401998|ref|YP_006438610.1| WP_014801624.1.12531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]