SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|522614047|ref|YP_008179737.1| from Alteromonas macleodii str. 'Ionian Sea UM7'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|522614047|ref|YP_008179737.1|
Domain Number 1 Region: 2-192
Classification Level Classification E-value
Superfamily ITPase-like 1.31e-50
Family Maf-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|522614047|ref|YP_008179737.1|
Sequence length 206
Comment maf protein [Alteromonas macleodii str. 'Ionian Sea UM7']
Sequence
MAHLILASSSQYRKMLLANIGIHVDTHAPDIDETPFNNEAPTALSVRLAEQKALKVASEL
VNVPRDTLIIGSDQVALVQSDDGPQLLGKPGNSDNAVKQLKACQGKEVTFYTALCLHQPA
TNKTVTQVDETRVYFRQNSEAALTAYVQKEQPLDCAGSFKSEGLGVLLFDKITSRDPNSL
IGLPIMLLNELLDVHFNVDLLAIAAQ
Download sequence
Identical sequences F2GA78 S5AEK1 S5BY31
gi|522569221|ref|YP_008171650.1| WP_012518204.1.21115 WP_012518204.1.24997 WP_012518204.1.30323 WP_012518204.1.35093 WP_012518204.1.36926 WP_012518204.1.68468 WP_012518204.1.96561 gi|522614047|ref|YP_008179737.1| gi|522589711|ref|YP_008175788.1| gi|522667586|ref|YP_008196048.1| gi|522815502|ref|YP_008183731.1| gi|410861444|ref|YP_006976678.1| gi|522650001|ref|YP_008192464.1| gi|332141132|ref|YP_004426870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]