SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_001530 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_001530
Domain Number 1 Region: 100-196
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.36e-20
Family Chaperone J-domain 0.0006
Further Details:      
 
Domain Number 2 Region: 241-400
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 6.02e-19
Family Sec63 N-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 508-595
Classification Level Classification E-value
Superfamily E set domains 0.0000000000238
Family Sec63 C-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_001530
Sequence length 634
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_4:74034-75938(+) | length=634
Sequence
MDSDTQFEFDDQMSLVFISSLLCIGLLLLLLIFLRRRYRTTPSFPCECSLCCEKHFRSSL
RRKKYTKLDVILLFLIVLFSSLFAFNVLYISRAEVPSPPEKFDPYHILSVTRGSSEKDIR
AAYRRLSLKYHPDKNKLESAKENFILVTRAYEVLTTPSKLRAWEETGRDEEDHGVTFGIG
MPSFLNGRKNKTFVLAFYGIVVVLLIPLGVFLLYSKCGGKSRGRAEYATNAAVSRIMREQ
MTLMKVVELLSFSTEFADLEIEQRDTTDLPLLVQKIKSQFRVEQKDFLPVPMKIQTLIGA
HLSRLHNEMPQYLRDELDYIIEKAPNVLNKLVYIMISKGNMEGVWSTLKVNQMITQATDN
ENEQIPDIDNNKENTTDIFKFEEFVQLSENERTAFVQKNYKINYKLPVNYSLKFFRYFPS
SVEFVVQAMSATMNQKVARGVPLMVLINAYRYPRENTGELSGRFKDKFSNIFESEGGERE
NQNEDVDDQQKINEHNEKVFFDDNKHEIKEDVYVHNPLCPNERLERWWYILTDASDSYVI
TATCGFIQISDRPTVIKIYAKNPNGVGKYHVNLHCICDAYINCEKTFHLDFDVVERTFED
ENEVSDASEEEMNGEEQKSDNEENERESVTNEEN
Download sequence
Identical sequences L7FJ22
jCVI|EIN_001530 XP_004182907.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]